Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A9BDU4

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSVRYWIIHAVTLPAIFIAGFLFVSTGLAYDAFGTPRPDTYFQAS ESKAPVVSQRFESKAQLDLRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LXRα Rabbit pAb
A2141-01 20 µL

LXRα Rabbit pAb

Sign In for Pricing
View Details
LXRα Rabbit pAb
A2141-02 100 μL

LXRα Rabbit pAb

Sign In for Pricing
View Details
LXRα Rabbit pAb
A2141-03 500 μL

LXRα Rabbit pAb

Sign In for Pricing
View Details
LXRα Rabbit pAb
A2141-04 1000 μL

LXRα Rabbit pAb

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-1902 Vector
mm30213 500 ng

LentimiRa-Off-mmu-miR-1902 Vector

Sign In for Pricing
View Details
CD239 (BCAM) Human Over-expression Lysate
orb1366930 20 µg

CD239 (BCAM) Human Over-expression Lysate

Sign In for Pricing
View Details