Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A9BDU4

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSVRYWIIHAVTLPAIFIAGFLFVSTGLAYDAFGTPRPDTYFQAS ESKAPVVSQRFESKAQLDLRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPB1 Knockout Cell Lysate
ABC-KC0879 100 µg

HSPB1 Knockout Cell Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal ENO3 Antibody (003) [CoraFluor 1]
NBP2-90274CL1 0.1 mL

Rabbit Monoclonal ENO3 Antibody (003) [CoraFluor 1]

Sign In for Pricing
View Details
C-SRC Monoclonal Antibody
E53M01936 100 µL

C-SRC Monoclonal Antibody

Sign In for Pricing
View Details
CD4 Antibody
orb640030-01 20 µg

CD4 Antibody

Sign In for Pricing
View Details
CD4 Antibody
orb640030-02 100 µg

CD4 Antibody

Sign In for Pricing
View Details
DSC1 ELISA Kit (Human) (OKCD00505)
OKCD00505 96 Well

DSC1 ELISA Kit (Human) (OKCD00505)

Sign In for Pricing
View Details