Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A9BDU4

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSVRYWIIHAVTLPAIFIAGFLFVSTGLAYDAFGTPRPDTYFQAS ESKAPVVSQRFESKAQLDLRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Leu-Trp-Met-Arg-OH
4002689.0250 250 mg

H-Leu-Trp-Met-Arg-OH

Sign In for Pricing
View Details
Ins-17 Antibody
orb800725 2 mg

Ins-17 Antibody

Sign In for Pricing
View Details
DIS3L2 (NM_152383) Human Untagged Clone
SC100996 10 µg

DIS3L2 (NM_152383) Human Untagged Clone

Sign In for Pricing
View Details
STAU1, NT (STAU1, STAU, Double-stranded RNA-binding protein Staufen homolog 1) (MaxLight 650) discontinued
042386-ML650 100 µL

STAU1, NT (STAU1, STAU, Double-stranded RNA-binding protein Staufen homolog 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-Prostaglandin E Receptor EP1/PTGER1 Antibody Picoband®, APC Conjugate
PA1583-APC 100 µg/Vial

Anti-Prostaglandin E Receptor EP1/PTGER1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
PE-conjugated Anti-CD24 antibody (DMC213); IgG1 Chimeric mAb
MBS1882011-01 100 Tests

PE-conjugated Anti-CD24 antibody (DMC213); IgG1 Chimeric mAb

Sign In for Pricing
View Details