Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9BCE3

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9211)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITTAASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium metasilicate nonahydrate
sc-251033 500 g

Sodium metasilicate nonahydrate

Sign In for Pricing
View Details
EpCAM Recombinant monoclonal antibody (rVU-1D9)
ENZ-ABS318-0100 100 µg

EpCAM Recombinant monoclonal antibody (rVU-1D9)

Sign In for Pricing
View Details
Human TIMM50 Recombinant Protein
PPT-15680 100 µg

Human TIMM50 Recombinant Protein

Sign In for Pricing
View Details
Copper (II) Sulphate 0.1M Solution
VM6201-F 2.5 L

Copper (II) Sulphate 0.1M Solution

Sign In for Pricing
View Details
PAI2 (Plasminogen Activator Inhibitor 2) BioAssayTM ELISA Kit (Equine) discontinued
357892-01 48 Tests

PAI2 (Plasminogen Activator Inhibitor 2) BioAssayTM ELISA Kit (Equine) discontinued

Sign In for Pricing
View Details
PAI2 (Plasminogen Activator Inhibitor 2) BioAssayTM ELISA Kit (Equine) discontinued
357892-02 96 Tests

PAI2 (Plasminogen Activator Inhibitor 2) BioAssayTM ELISA Kit (Equine) discontinued

Sign In for Pricing
View Details