Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptothrix cholodnii ATP synthase subunit c (atpE)

This Recombinant Leptothrix cholodnii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1Y3T2

Expression Region

1-82

Origin

Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGLVALACGIIIGLGAIGACIGIALMGGKYLEASARQPELMNELQTKMFLLAGLID AAFLIGVGIAMLFAFANPFVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p100 Nuclear Coactivator, guinea pig pab
GP25 100 µL

Anti-p100 Nuclear Coactivator, guinea pig pab

Sign In for Pricing
View Details
RMND1 Antibody - middle region
ARP57061_P050-25UL 25 µL

RMND1 Antibody - middle region

Sign In for Pricing
View Details
Camel Ovalbumin Specific Immunoglobulin E ELISA Kit
MBS068484-01 48 Well

Camel Ovalbumin Specific Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Camel Ovalbumin Specific Immunoglobulin E ELISA Kit
MBS068484-02 96 Well

Camel Ovalbumin Specific Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Camel Ovalbumin Specific Immunoglobulin E ELISA Kit
MBS068484-03 5x 96 Well

Camel Ovalbumin Specific Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Camel Ovalbumin Specific Immunoglobulin E ELISA Kit
MBS068484-04 10x 96 Well

Camel Ovalbumin Specific Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details