Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptothrix cholodnii ATP synthase subunit c (atpE)

This Recombinant Leptothrix cholodnii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1Y3T2

Expression Region

1-82

Origin

Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGLVALACGIIIGLGAIGACIGIALMGGKYLEASARQPELMNELQTKMFLLAGLID AAFLIGVGIAMLFAFANPFVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADAC Antibody
A11476-100UG 100 µg

AADAC Antibody

Sign In for Pricing
View Details
Human INPP1 Recombinant Protein C-6 His Tag Lyophilized
MBS8432545-01 0.05 mg

Human INPP1 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Human INPP1 Recombinant Protein C-6 His Tag Lyophilized
MBS8432545-02 5x 0.05 mg

Human INPP1 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
STAINperfect Immunostaining Kit A
IMS-SP-A-1000 1 Kit

STAINperfect Immunostaining Kit A

Sign In for Pricing
View Details
Tsr Recombinant Protein
OPCA02924-20UG 20 µg

Tsr Recombinant Protein

Sign In for Pricing
View Details
Anti-IGSF3 Antibody
CQA4769-01 30 µL

Anti-IGSF3 Antibody

Sign In for Pricing
View Details