Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8HPJ7

Expression Region

1-82

Origin

Cyanothece sp. (strain PCC 7425 / ATCC 29141)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQIASASVLAAALAIGLAAIGPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coch Mouse Gene Knockout Kit (CRISPR)
KN503603 1 Kit

Coch Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832S-01 20 Tests

Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832S-02 100 Tests

Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832S-03 2x 100 Tests

Elab Fluor® Red 780 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
GAD65 Recombinant Chimeric Antibody Antibody
HA601473 100 µL

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
4,4-Difluoropiperidine
TRC-D451310-250MG 250 mg

4,4-Difluoropiperidine

Sign In for Pricing
View Details