Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8HPJ7

Expression Region

1-82

Origin

Cyanothece sp. (strain PCC 7425 / ATCC 29141)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQIASASVLAAALAIGLAAIGPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG16L1 Polyclonal Antibody
E-AB-19375-01 20 µL

ATG16L1 Polyclonal Antibody

Sign In for Pricing
View Details
ATG16L1 Polyclonal Antibody
E-AB-19375-02 60 µL

ATG16L1 Polyclonal Antibody

Sign In for Pricing
View Details
ATG16L1 Polyclonal Antibody
E-AB-19375-03 120 µL

ATG16L1 Polyclonal Antibody

Sign In for Pricing
View Details
ATG16L1 Polyclonal Antibody
E-AB-19375-04 200 µL

ATG16L1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Nucleobindin 1 (NUCB1) ELISA Kit
RD-NUCB1-Hu-01 96 Tests

Human Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
Human Nucleobindin 1 (NUCB1) ELISA Kit
RD-NUCB1-Hu-02 48 Tests

Human Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details