Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8HPJ7

Expression Region

1-82

Origin

Cyanothece sp. (strain PCC 7425 / ATCC 29141)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQIASASVLAAALAIGLAAIGPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHDH Rabbit Polyclonal Antibody
TA365294 100 µL

DHDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5mL MacroTubes®
C2500-B 200 Sheets/Pack

5mL MacroTubes®

Sign In for Pricing
View Details
Transcription factor AP-2-alpha Recombinant Rabbit Monoclonal Antibody [PSH02-06]
HA721765 100 µL

Transcription factor AP-2-alpha Recombinant Rabbit Monoclonal Antibody [PSH02-06]

Sign In for Pricing
View Details
Syna Mouse Gene Knockout Kit (CRISPR)
KN517050 1 Kit

Syna Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC36A1 Rabbit Polyclonal Antibody
TA358679 100 µL

SLC36A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant COL6A1 Antibody
RC-4727-01 50 μL

Recombinant COL6A1 Antibody

Sign In for Pricing
View Details