Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybeF (ybeF)

This Recombinant Bacillus subtilis Uncharacterized protein ybeF (ybeF) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein ybeF

UniProt

O31442

Expression Region

1-82

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYS LVSLALSYITLIVVRKRKESGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM246 siRNA (Mouse)
orb1842309-01 15 nmol

TMEM246 siRNA (Mouse)

Sign In for Pricing
View Details
TMEM246 siRNA (Mouse)
orb1842309-02 30 nmol

TMEM246 siRNA (Mouse)

Sign In for Pricing
View Details
Nck Rabbit pAb
APA1281-01 30 µL

Nck Rabbit pAb

Sign In for Pricing
View Details
Nck Rabbit pAb
APA1281-02 50 μL

Nck Rabbit pAb

Sign In for Pricing
View Details
Nck Rabbit pAb
APA1281-03 100 µL

Nck Rabbit pAb

Sign In for Pricing
View Details
Goat anti-Rabbit IgG (H+L), Cross absorbed against Human immunoglobulins, HRPO Conjugated
MBS8579704-01 0.1 mL

Goat anti-Rabbit IgG (H+L), Cross absorbed against Human immunoglobulins, HRPO Conjugated

Sign In for Pricing
View Details