Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybeF (ybeF)

This Recombinant Bacillus subtilis Uncharacterized protein ybeF (ybeF) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein ybeF

UniProt

O31442

Expression Region

1-82

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYS LVSLALSYITLIVVRKRKESGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERP27 Protein Vector (Human) (pPM-C-His)
PV014572 500 ng

ERP27 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human HTT, N-His
MBS1574026-01 0.1 mg

Recombinant Human HTT, N-His

Sign In for Pricing
View Details
Recombinant Human HTT, N-His
MBS1574026-02 1 mg

Recombinant Human HTT, N-His

Sign In for Pricing
View Details
Recombinant Human HTT, N-His
MBS1574026-03 5x 1 mg

Recombinant Human HTT, N-His

Sign In for Pricing
View Details
SERT-IN-2
BA8548-1 1 mg

SERT-IN-2

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 5 (PTPN5)
MBS2071934-01 0.1 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 5 (PTPN5)

Sign In for Pricing
View Details