Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0P3K7

Expression Region

1-82

Origin

Ostreococcus tauri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLICAASVVGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALMFANPFVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rattus norvegicus Pyruvate kinase PKLR
MBS9422441-01 0.02 mg

Recombinant Rattus norvegicus Pyruvate kinase PKLR

Sign In for Pricing
View Details
Recombinant Rattus norvegicus Pyruvate kinase PKLR
MBS9422441-02 0.1 mg

Recombinant Rattus norvegicus Pyruvate kinase PKLR

Sign In for Pricing
View Details
Recombinant Rattus norvegicus Pyruvate kinase PKLR
MBS9422441-03 1 mg

Recombinant Rattus norvegicus Pyruvate kinase PKLR

Sign In for Pricing
View Details
Recombinant Rattus norvegicus Pyruvate kinase PKLR
MBS9422441-04 5x 1 mg

Recombinant Rattus norvegicus Pyruvate kinase PKLR

Sign In for Pricing
View Details
PGPEP1 Human Pre-designed siRNA Set A
HY-RS10395 1 Set

PGPEP1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
PLV3-CMV-DVL2-3xMyc-Puro Plasmid
PVT75768 2 µg

PLV3-CMV-DVL2-3xMyc-Puro Plasmid

Sign In for Pricing
View Details