Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. ATP synthase subunit c (atpE)

This Recombinant Polaromonas sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q12GQ5

Expression Region

1-82

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHVLGFVALAAGLIIGLGAVGACIGIGIMGSKYLEAAARQPELMNELQTKMFLLAGLID AAFLIGVGIAMMFAFANPFVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660R Conjugate, 0.1 mg/mL
BNC611331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660R Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
Mesd Mouse Monoclonal Antibody [Clone ID: N88/12]
75-129 100 µL

Mesd Mouse Monoclonal Antibody [Clone ID: N88/12]

Sign In for Pricing
View Details
TOMM20 Recombinant Chimeric Antibody Antibody
HA601454 100 µL

TOMM20 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Cy3® goat anti-rabbit IgG (H+L)
16870-AAT 1 mg

Cy3® goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
DOG-1 (DG1/447), Biotin conjugate, 0.1mg/mL
BNCB0447-500 1x 500 µL

DOG-1 (DG1/447), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCD2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
CF810066 100 µg

ABCD2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

Sign In for Pricing
View Details