Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. ATP synthase subunit c (atpE)

This Recombinant Polaromonas sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q12GQ5

Expression Region

1-82

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHVLGFVALAAGLIIGLGAVGACIGIGIMGSKYLEAAARQPELMNELQTKMFLLAGLID AAFLIGVGIAMMFAFANPFVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL10 / IP-10 Recombinant Rabbit monoclonal Antibody
HA725007 100 µL

Human CXCL10 / IP-10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human TBLR1 (TBL1XR1) activation kit by CRISPRa
GA112573 1 Kit

Human TBLR1 (TBL1XR1) activation kit by CRISPRa

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF740 conjugate, 0.1mg/mL
BNC740833-100 1x 100 µL

Calponin-1 (CALP + CNN1/832), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Boc-Ibrutinib-d4
TRC-B656717-5MG 5 mg

N-Boc-Ibrutinib-d4

Sign In for Pricing
View Details
MPV17 (N-term) Rabbit Polyclonal Antibody
AP18119PU-N 400 µL

MPV17 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Drying Oven BODR-7002
BODR-7002 1 Unit

Drying Oven BODR-7002

Sign In for Pricing
View Details