Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Envelope small membrane protein (E)

This Recombinant Human coronavirus HKU1 Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q14EA8

Expression Region

1-82

Origin

Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDVFFTDTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYVYN RGRQLYKSYSEHVIPSTLDDLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A Sulfonyl Chloride
HA1000431.1G 1 g

Polystyrene A Sulfonyl Chloride

Sign In for Pricing
View Details
MOT4 Antibody
8C16692-AAT 50 µg

MOT4 Antibody

Sign In for Pricing
View Details
Recombinant STAT4 Antibody
RC-5928-01 50 μL

Recombinant STAT4 Antibody

Sign In for Pricing
View Details
Recombinant STAT4 Antibody
RC-5928-02 100 µL

Recombinant STAT4 Antibody

Sign In for Pricing
View Details
Recombinant STAT4 Antibody
RC-5928-03 1 mL

Recombinant STAT4 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS621129 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details