Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1KVY0

Expression Region

1-82

Origin

Scenedesmus obliquus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIVAAASVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPF0556 protein C19orf10
orb1645135-01 50 µg

UPF0556 protein C19orf10

Sign In for Pricing
View Details
UPF0556 protein C19orf10
orb1645135-02 100 µg

UPF0556 protein C19orf10

Sign In for Pricing
View Details
UPF0556 protein C19orf10
orb1645135-03 1 mg

UPF0556 protein C19orf10

Sign In for Pricing
View Details
Hydrocortisone 17-Propionate
sc-489982 100 mg

Hydrocortisone 17-Propionate

Sign In for Pricing
View Details
AKR1A1 rabbit pAb Antibody
orb764499-01 50 μL

AKR1A1 rabbit pAb Antibody

Sign In for Pricing
View Details
AKR1A1 rabbit pAb Antibody
orb764499-02 100 µL

AKR1A1 rabbit pAb Antibody

Sign In for Pricing
View Details