Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1KVY0

Expression Region

1-82

Origin

Scenedesmus obliquus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIVAAASVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1359634 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7287006 1.0 µg DNA

RGD1359634 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) sec61 Polyclonal Antibody
MBS7148783 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) sec61 Polyclonal Antibody

Sign In for Pricing
View Details
BBP35-ST-In-3Y Training Services
321357 1 Pack (1 Piece (s) x 1 Piece)

BBP35-ST-In-3Y Training Services

Sign In for Pricing
View Details
Rabbit Monoclonal CD300c Antibody (105)
NBP2-89993-100ul 100 µL

Rabbit Monoclonal CD300c Antibody (105)

Sign In for Pricing
View Details
70nm Endotoxin Free NanoUrchins
UEF-70-100-10 100 mL

70nm Endotoxin Free NanoUrchins

Sign In for Pricing
View Details
Lentiviral human LAMB3 shRNA (UAS) - Lentiviral human LAMB3 shRNA (UAS, RFP) plasmid
GTR15321508 1 Vial

Lentiviral human LAMB3 shRNA (UAS) - Lentiviral human LAMB3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details