Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Immediate early response 3-interacting protein 1 (ier3ip1)

This Recombinant Xenopus laevis Immediate early response 3-interacting protein 1 (ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

Q3B8G7

Expression Region

1-82

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYTLLQAALLCVNAVAVLHEERFLSKIGWGVDHGIGGFGEEPGMKSQLMNLIRSVR TVMRVPLIIVNSVTIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-100 1x 100 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL
BNC940183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), CF640R conjugate, 0.1mg/mL
BNC402473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details