Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE)

This Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q3MC09

Expression Region

1-82

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class 2, RT1D (MHC Class II) (APC)
MBS6269004-01 0.1 mL

MHC Class 2, RT1D (MHC Class II) (APC)

Sign In for Pricing
View Details
MHC Class 2, RT1D (MHC Class II) (APC)
MBS6269004-02 5x 0.1 mL

MHC Class 2, RT1D (MHC Class II) (APC)

Sign In for Pricing
View Details
Styphnolobium japonicum Lectin (SJA) - AP (Alkaline Phosphatase)
21510878-1 1 mg

Styphnolobium japonicum Lectin (SJA) - AP (Alkaline Phosphatase)

Sign In for Pricing
View Details
Recombinant Mouse IL36γ / Interleukin-36 gamma, Animal Free & Carrier Free
C-CYP190-5ug 5 µg

Recombinant Mouse IL36γ / Interleukin-36 gamma, Animal Free & Carrier Free

Sign In for Pricing
View Details
Tert-Butyl 3-[ (butan-2-yl) amino]propanoate
WYB34128-01 0.5 g

Tert-Butyl 3-[ (butan-2-yl) amino]propanoate

Sign In for Pricing
View Details
Tert-Butyl 3-[ (butan-2-yl) amino]propanoate
WYB34128-02 5 g

Tert-Butyl 3-[ (butan-2-yl) amino]propanoate

Sign In for Pricing
View Details