Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE)

This Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q3MC09

Expression Region

1-82

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TTC11/FIS1 Antibody Picoband®, Cy3 Conjugate
A01932-3-Cy3 100 µg/Vial

Anti-TTC11/FIS1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (Biotin)
MBS6171180-01 0.1 mL

TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (Biotin)

Sign In for Pricing
View Details
TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (Biotin)
MBS6171180-02 5x 0.1 mL

TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Oplah shRNA (UAS) - Lentiviral mouse Oplah shRNA (UAS, GFP) plasmid
GTR15257362 1 Vial

Lentiviral mouse Oplah shRNA (UAS) - Lentiviral mouse Oplah shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Phax sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3104107 1.0 µg DNA

Phax sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
UBE2Q2 Rabbit pAb
E45R28831N-100 100 µL

UBE2Q2 Rabbit pAb

Sign In for Pricing
View Details