Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE)

This Recombinant Anabaena variabilis Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q3MC09

Expression Region

1-82

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant (E. coli) Hepatitis B surface Antigen (HBsAg, Ad) (>95%)
HBSAG21-R-25 25 µg

Recombinant (E. coli) Hepatitis B surface Antigen (HBsAg, Ad) (>95%)

Sign In for Pricing
View Details
Mouse Skin Tissue Lysate 100ug
IMSSKNTL100UG 100 µg

Mouse Skin Tissue Lysate 100ug

Sign In for Pricing
View Details
NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX) (FITC)
130545-FITC 100 µL

NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX) (FITC)

Sign In for Pricing
View Details
Human Kelch-like protein 18, KLHL18 ELISA Kit
MBS9330238-01 48 Well

Human Kelch-like protein 18, KLHL18 ELISA Kit

Sign In for Pricing
View Details
Human Kelch-like protein 18, KLHL18 ELISA Kit
MBS9330238-02 96 Well

Human Kelch-like protein 18, KLHL18 ELISA Kit

Sign In for Pricing
View Details
Human Kelch-like protein 18, KLHL18 ELISA Kit
MBS9330238-03 5x 96 Well

Human Kelch-like protein 18, KLHL18 ELISA Kit

Sign In for Pricing
View Details