Recombinant Synechococcus sp. ATP synthase subunit c (atpE)
This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q3AHK1
Expression Region
1-82
Origin
Synechococcus sp. (strain CC9605)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY431764 100 µg
alpha Synuclein (SNCA) (NM_001146055) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC042111-500 1x 500 µL
MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH032343-01 10 µg
Recombinant Human DCBLD2/ESDN Protein (aa 67-528, His Tag)
Sign In for Pricing
View Details PKSH032343-02 50 µg
Recombinant Human DCBLD2/ESDN Protein (aa 67-528, His Tag)
Sign In for Pricing
View Details