Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3AHK1

Expression Region

1-82

Origin

Synechococcus sp. (strain CC9605)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,
BAF-431-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3275), CF740 conjugate, 0.1mg/mL
BNC743275-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3275), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF768 Human Gene Knockout Kit (CRISPR)
KN402235 1 Kit

ZNF768 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Serine-13C3
TRC-S270999-25MG 25 mg

L-Serine-13C3

Sign In for Pricing
View Details
COX5A Polyclonal Antibody
E-AB-16248-01 20 µL

COX5A Polyclonal Antibody

Sign In for Pricing
View Details
COX5A Polyclonal Antibody
E-AB-16248-02 60 µL

COX5A Polyclonal Antibody

Sign In for Pricing
View Details