Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4G3A1

Expression Region

1-82

Origin

Emiliania huxleyi

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIVSGASVIAAGLAIGLASIGPGIGQGTAAAQAVEGLARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALCLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenovirus (ADV) (MaxLight 750) discontinued
226828-ML750 100 µL

Adenovirus (ADV) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Normal Human Trachea (single section per slide)
HuFPT110 5 Slides/Pack

Normal Human Trachea (single section per slide)

Sign In for Pricing
View Details
SORD siRNA (Human)
orb1863726-01 15 nmol

SORD siRNA (Human)

Sign In for Pricing
View Details
SORD siRNA (Human)
orb1863726-02 30 nmol

SORD siRNA (Human)

Sign In for Pricing
View Details
GPR161 3'UTR Luciferase Stable Cell Line
TU009241 1.0 mL

GPR161 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SSX7 antibody
70R-9113 100 µL

SSX7 antibody

Sign In for Pricing
View Details