Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q46J53

Expression Region

1-82

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITTAASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asl ORF Vector (Mouse) (pORF)
12545014 1.0 µg DNA

Asl ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
EIF4B Polyclonal Antibody
MBS2554919-01 0.06 mL

EIF4B Polyclonal Antibody

Sign In for Pricing
View Details
EIF4B Polyclonal Antibody
MBS2554919-02 0.12 mL

EIF4B Polyclonal Antibody

Sign In for Pricing
View Details
EIF4B Polyclonal Antibody
MBS2554919-03 0.2 mL

EIF4B Polyclonal Antibody

Sign In for Pricing
View Details
EIF4B Polyclonal Antibody
MBS2554919-04 5x 0.2 mL

EIF4B Polyclonal Antibody

Sign In for Pricing
View Details
Slc25a34 Rat shRNA Plasmid (Locus ID 298606)
TR702072 1 Kit

Slc25a34 Rat shRNA Plasmid (Locus ID 298606)

Sign In for Pricing
View Details