Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Immediate early response 3-interacting protein 1 (ier3ip1)

This Recombinant Danio rerio Immediate early response 3-interacting protein 1 (ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

Q4VBI2

Expression Region

1-82

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYALIQTAILFTNAIAVLHEERFLSKIGWGAEQGVGGFGDDPGIKAQLLNLIRSVR TVMRVPLIAVNSVCIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF606 antibody
FNab09719 100 µg

ZNF606 antibody

Sign In for Pricing
View Details
Cdrt4 Mouse Gene Knockout Kit (CRISPR)
KN503074 1 Kit

Cdrt4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF568 conjugate, 0.1mg/mL
BNC682304-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ORC2 (1-577) Mouse Monoclonal Antibody [Clone ID: 3B7]
AM26604AF-N 100 µg

ORC2 (1-577) Mouse Monoclonal Antibody [Clone ID: 3B7]

Sign In for Pricing
View Details
SNAP45 (SNAPC2) (NM_003083) Human Recombinant Protein
TP304157M 100 µg

SNAP45 (SNAPC2) (NM_003083) Human Recombinant Protein

Sign In for Pricing
View Details
Glycyl-L-Tyrosine Dihydrate
TRC-G765040-2.5G 2.5 g

Glycyl-L-Tyrosine Dihydrate

Sign In for Pricing
View Details