Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Immediate early response 3-interacting protein 1 (ier3ip1)

This Recombinant Danio rerio Immediate early response 3-interacting protein 1 (ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

Q4VBI2

Expression Region

1-82

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYALIQTAILFTNAIAVLHEERFLSKIGWGAEQGVGGFGDDPGIKAQLLNLIRSVR TVMRVPLIAVNSVCIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE2A (NM_002599) Human Over-expression Lysate
LC419215 20 µg

PDE2A (NM_002599) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), CF740 conjugate, 0.1mg/mL
BNC740760-100 1x 100 µL

Cytokeratin 7 (KRT7/760), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A10 (NM_002966) Human Over-expression Lysate
LY401038 100 µg

S100A10 (NM_002966) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat SELL (L-Selectin) ELISA Kit
E-EL-R0596-01 24 Tests

Rat SELL (L-Selectin) ELISA Kit

Sign In for Pricing
View Details
Rat SELL (L-Selectin) ELISA Kit
E-EL-R0596-02 48 Tests

Rat SELL (L-Selectin) ELISA Kit

Sign In for Pricing
View Details
Rat SELL (L-Selectin) ELISA Kit
E-EL-R0596-03 96 Tests

Rat SELL (L-Selectin) ELISA Kit

Sign In for Pricing
View Details