Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Envelope small membrane protein (E)

This Recombinant Human coronavirus HKU1 Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q5MQC8

Expression Region

1-82

Origin

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDLFFNDTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYVYK RGMQLYKSYSEQVIPPTSDYLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaved-Integrin α5 HC (F42) Polyclonal Antibody
RA23494-01 50 µL

Cleaved-Integrin α5 HC (F42) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-Integrin α5 HC (F42) Polyclonal Antibody
RA23494-02 100 µL

Cleaved-Integrin α5 HC (F42) Polyclonal Antibody

Sign In for Pricing
View Details
LPAM-1 (Integrin alpha 4 beta 7, Lymphocyte Peyer ́s Patch Adhesion Molecule 1, CD49d/Ly69) (Azide Free)
046182 100 µg

LPAM-1 (Integrin alpha 4 beta 7, Lymphocyte Peyer ́s Patch Adhesion Molecule 1, CD49d/Ly69) (Azide Free)

Sign In for Pricing
View Details
Mouse Monoclonal Coronavirus Antibody (FIPV3-70) [Allophycocyanin]
NB100-64754APC 0.1 mL

Mouse Monoclonal Coronavirus Antibody (FIPV3-70) [Allophycocyanin]

Sign In for Pricing
View Details
Human Ferritin (L chain) Protein
abx060149 1 mg

Human Ferritin (L chain) Protein

Sign In for Pricing
View Details
EIF4E Rabbit pAb
A0468-01 20 µL

EIF4E Rabbit pAb

Sign In for Pricing
View Details