Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE)

This Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5P4E7

Expression Region

1-82

Origin

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELMNALQTKMFLLAGLID AAFLIGVGIAMMFAFANPFQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LH 846
SIH-503-5MG 5 mg

LH 846

Sign In for Pricing
View Details
Mouse αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-M2405-01 24 Tests

Mouse αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Mouse αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-M2405-02 48 Tests

Mouse αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Mouse αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-M2405-03 96 Tests

Mouse αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
AAV5 Mouse Monoclonal Antibody [Clone ID: OTI16H1]
CF816057 100 µg

AAV5 Mouse Monoclonal Antibody [Clone ID: OTI16H1]

Sign In for Pricing
View Details
HTR3C Polyclonal Antibody
E-AB-10968-01 20 µL

HTR3C Polyclonal Antibody

Sign In for Pricing
View Details