Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE)

This Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5P4E7

Expression Region

1-82

Origin

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELMNALQTKMFLLAGLID AAFLIGVGIAMMFAFANPFQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Iron Assay Kit
DIFE-250 250 Tests

QuantiChrom™ Iron Assay Kit

Sign In for Pricing
View Details
Recombinant PRPF4 Antibody
RC-5881-01 50 μL

Recombinant PRPF4 Antibody

Sign In for Pricing
View Details
Recombinant PRPF4 Antibody
RC-5881-02 100 µL

Recombinant PRPF4 Antibody

Sign In for Pricing
View Details
Recombinant PRPF4 Antibody
RC-5881-03 1 mL

Recombinant PRPF4 Antibody

Sign In for Pricing
View Details
3-(Oxan-4-yl)pentanedioic Acid
TRC-O845280-25MG 25 mg

3-(Oxan-4-yl)pentanedioic Acid

Sign In for Pricing
View Details
NXF3 Antibody
8C17132-AAT 50 µg

NXF3 Antibody

Sign In for Pricing
View Details