Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE)

This Recombinant Aromatoleum aromaticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5P4E7

Expression Region

1-82

Origin

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELMNALQTKMFLLAGLID AAFLIGVGIAMMFAFANPFQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP7A1 Rabbit Polyclonal Antibody
HA500207 100 µL

CYP7A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-IKB alpha (S36) Recombinant Rabbit Monoclonal Antibody [JE56-65]
HA721802 100 µL

Phospho-IKB alpha (S36) Recombinant Rabbit Monoclonal Antibody [JE56-65]

Sign In for Pricing
View Details
BTBD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13F6]
TA808669BM 100 µL

BTBD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13F6]

Sign In for Pricing
View Details
Gata3 Antibody
KC-359-01 50 μL

Gata3 Antibody

Sign In for Pricing
View Details
Gata3 Antibody
KC-359-02 100 µL

Gata3 Antibody

Sign In for Pricing
View Details
Gata3 Antibody
KC-359-03 1 mL

Gata3 Antibody

Sign In for Pricing
View Details