Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng Cytochrome b559 subunit alpha (psbE)

This Recombinant Panax ginseng Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q68RY9

Expression Region

2-83

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQ GIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), 0.2mg/mL
BNUB1780-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), 0.2mg/mL

Sign In for Pricing
View Details
HSPA1L Recombinant Mouse monoclonal Antibody
HA610120 100 µg

HSPA1L Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
N-(2-Chloroethyl)benzenesulfonamide
TRC-C867540-5G 5 g

N-(2-Chloroethyl)benzenesulfonamide

Sign In for Pricing
View Details
LAMC1 Antibody
8C13072-AAT 50 µg

LAMC1 Antibody

Sign In for Pricing
View Details
LC3B (MAP1LC3B) Rabbit Polyclonal Antibody
TA378232 100 µL

LC3B (MAP1LC3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB600791 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details