Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng Cytochrome b559 subunit alpha (psbE)

This Recombinant Panax ginseng Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q68RY9

Expression Region

2-83

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQ GIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-
BA-1802-2 2 mg

Biotin Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-

Sign In for Pricing
View Details
Mouse 4930563E18Rik activation kit by CRISPRa
GA210188 1 Kit

Mouse 4930563E18Rik activation kit by CRISPRa

Sign In for Pricing
View Details
PE-iFluor® 597 Tandem
2601-AAT 1 mg

PE-iFluor® 597 Tandem

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS624375 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]
AM20322PU-T 20 µg

CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), 0.2mg/mL
BNUB0954-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), 0.2mg/mL

Sign In for Pricing
View Details