Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE)

This Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q6EW36

Expression Region

2-83

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSTGERAFADIITSIRYWVIHSITIPSLFIAGWSFVSTGLAYDVFGSPRPNEYFTESRQ GIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ATL1/SPG3A/Atlastin-1 Protein (GST Tag)
PKSH031549 100 µg

Recombinant Human ATL1/SPG3A/Atlastin-1 Protein (GST Tag)

Sign In for Pricing
View Details
IFI16 Rabbit Polyclonal Antibody
TA367683 100 µL

IFI16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS635358 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
Caveolin 1 (CAV1) pTyr14 Rabbit Polyclonal Antibody
AP02388PU-N 100 µL

Caveolin 1 (CAV1) pTyr14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLDN25 (NM_001101389) Human Over-expression Lysate
LC426152 20 µg

CLDN25 (NM_001101389) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-Xanthoanthrafil
TRC-X500005-1MG 1 mg

(R)-Xanthoanthrafil

Sign In for Pricing
View Details