Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE)

This Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q6EW36

Expression Region

2-83

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSTGERAFADIITSIRYWVIHSITIPSLFIAGWSFVSTGLAYDVFGSPRPNEYFTESRQ GIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF405S conjugate, 0.1mg/mL
BNC041836-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse CXCL16 Recombinant Rabbit monoclonal Antibody
HA723940 100 µL

Mouse CXCL16 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF647 conjugate, 0.1mg/mL
BNC473019-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EHMT1/GLP (EHMT1) (N-term) Rabbit Polyclonal Antibody
AP11092PU-N 400 µL

EHMT1/GLP (EHMT1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF640R conjugate, 0.1mg/mL
BNC402223-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SuLT1C4 (NM_006588) Human Recombinant Protein
TP313146L 1 mg

SuLT1C4 (NM_006588) Human Recombinant Protein

Sign In for Pricing
View Details