Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q7V4Q2

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQAS ESKAPVVSQRYEAKSQLDLRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIH1 Protein Vector (Human) (pPB-C-His)
PV053285 500 ng

IFIH1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Zfp295 Protein Vector (Mouse) (pPB-C-His)
PV249206 500 ng

Zfp295 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Ercc5 shRNA (UAS) - Lentiviral mouse Ercc5 shRNA (UAS, iRFP) (100)
GTR15170127 1 Vial

Lentiviral mouse Ercc5 shRNA (UAS) - Lentiviral mouse Ercc5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Chrnd Pre-designed siRNA Set B
SI102572B 1 Each

Mouse Chrnd Pre-designed siRNA Set B

Sign In for Pricing
View Details
DAD1 Polyclonal Antibody
MBS9238086-01 0.1 mL

DAD1 Polyclonal Antibody

Sign In for Pricing
View Details
DAD1 Polyclonal Antibody
MBS9238086-02 5x 0.1 mL

DAD1 Polyclonal Antibody

Sign In for Pricing
View Details