Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q7V4Q2

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQAS ESKAPVVSQRYEAKSQLDLRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gh qPCR Primer Pair
QM02818S 200 Tests

Mouse Gh qPCR Primer Pair

Sign In for Pricing
View Details
Gamma Adaptin (AP1G1) Human Over-expression Lysate
orb1344406 100 µg

Gamma Adaptin (AP1G1) Human Over-expression Lysate

Sign In for Pricing
View Details
TLR7, CT (TLR7, Toll-like receptor 7) (Azide free) (HRP)
MBS6355914-01 0.2 mL

TLR7, CT (TLR7, Toll-like receptor 7) (Azide free) (HRP)

Sign In for Pricing
View Details
TLR7, CT (TLR7, Toll-like receptor 7) (Azide free) (HRP)
MBS6355914-02 5x 0.2 mL

TLR7, CT (TLR7, Toll-like receptor 7) (Azide free) (HRP)

Sign In for Pricing
View Details
Vercirnon
BA5246-25 25 mg

Vercirnon

Sign In for Pricing
View Details
Substance P (5-11) (TFA)
HY-P3890A-01 1 mg

Substance P (5-11) (TFA)

Sign In for Pricing
View Details