Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)

This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q7V4Q2

Expression Region

1-82

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQAS ESKAPVVSQRYEAKSQLDLRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IARS, NT (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, FLJ20736, Isoleucine-tRNA Ligase, PRO0785) (Biotin)
MBS6481362-01 0.2 mL

IARS, NT (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, FLJ20736, Isoleucine-tRNA Ligase, PRO0785) (Biotin)

Sign In for Pricing
View Details
IARS, NT (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, FLJ20736, Isoleucine-tRNA Ligase, PRO0785) (Biotin)
MBS6481362-02 5x 0.2 mL

IARS, NT (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, FLJ20736, Isoleucine-tRNA Ligase, PRO0785) (Biotin)

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7205216-01 48 Well

Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7205216-02 96 Well

Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7205216-03 5x 96 Well

Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7205216-04 10x 96 Well

Monkey Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details