Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF R alpha, Rat (HEK293, His)

PDGF R alpha protein is a tyrosine protein kinase receptor for PDGFA, PDGFB, and PDGFC that coordinates embryonic development, cell proliferation, survival, and chemotaxis. Their functions vary, promoting or inhibiting cell proliferation and migration depending on the situation. PDGF R alpha Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R alpha protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PDGF R alpha Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-r-alpha-protein-rat-hek293-his.html

Purity

98.0

Smiles

LLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYVPDPDMAFVPLGMTDSLVIVEEDDSAIIPCLTTDPDTEVTLHNNGRLVPASYDSRQGFNGTFSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNEVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKEMKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLTEITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELVDDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGRSTVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPSLRSE

Molecular Formula

25267 (Gene_ID) NP_036934.1 (L24-E523) (Accession)

Molecular Weight

Approximately 70-115 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL23AP25 3'UTR GFP Stable Cell Line
TU071088 1.0 mL

RPL23AP25 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HES3 Antibody Blocking Peptide
orb1514190 500 µg

HES3 Antibody Blocking Peptide

Sign In for Pricing
View Details
Interleukin-12/IL-12 Protein (C-His, Human)
P516385 100 µg

Interleukin-12/IL-12 Protein (C-His, Human)

Sign In for Pricing
View Details
HIST2H2BB siRNA (Mouse)
CRN4277-01 15 nmol

HIST2H2BB siRNA (Mouse)

Sign In for Pricing
View Details
HIST2H2BB siRNA (Mouse)
CRN4277-02 30 nmol

HIST2H2BB siRNA (Mouse)

Sign In for Pricing
View Details
PALMD (NM_017734) Human Recombinant Protein
TP303079M 100 µg

PALMD (NM_017734) Human Recombinant Protein

Sign In for Pricing
View Details