Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq)

This Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Low molecular mass ubiquinone-binding protein, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquino

UniProt

Q7TQ16

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid
TRC-H294375-250MG 250 mg

(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Heme Oxygenase 1 (HO-1) Recombinant Rabbit Monoclonal Antibody [SP08-07]
HA720169F 100 µL

iFluor™ 594 Conjugated Heme Oxygenase 1 (HO-1) Recombinant Rabbit Monoclonal Antibody [SP08-07]

Sign In for Pricing
View Details
choA Goat Polyclonal Antibody
TA396670S 25 µL

choA Goat Polyclonal Antibody

Sign In for Pricing
View Details
Spermine-d20
TRC-S680512-1MG 1 mg

Spermine-d20

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody [Clone ID: PC10]
AM10035PU-S 500 µL

PCNA Mouse Monoclonal Antibody [Clone ID: PC10]

Sign In for Pricing
View Details
6-(6-(6-Aminohexanamido)hexanamido)hexanoic Acid
TRC-A618823-250MG 250 mg

6-(6-(6-Aminohexanamido)hexanamido)hexanoic Acid

Sign In for Pricing
View Details