Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq)

This Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Low molecular mass ubiquinone-binding protein, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquino

UniProt

Q7TQ16

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP85 Polyclonal Antibody
E-AB-66616-01 60 µL

CEP85 Polyclonal Antibody

Sign In for Pricing
View Details
CEP85 Polyclonal Antibody
E-AB-66616-02 120 µL

CEP85 Polyclonal Antibody

Sign In for Pricing
View Details
CEP85 Polyclonal Antibody
E-AB-66616-03 200 µL

CEP85 Polyclonal Antibody

Sign In for Pricing
View Details
IL11RA Human Gene Knockout Kit (CRISPR)
KN400654 1 Kit

IL11RA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GATC (NM_176818) Human Recombinant Protein
TP315964M 100 µg

GATC (NM_176818) Human Recombinant Protein

Sign In for Pricing
View Details
DGKK Antibody
8C11181-AAT 50 µg

DGKK Antibody

Sign In for Pricing
View Details