Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq)

This Recombinant Rat Cytochrome b-c1 complex subunit 8 (Uqcrq) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Low molecular mass ubiquinone-binding protein, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquino

UniProt

Q7TQ16

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fencamfamin-d5 Hydrochloride
TRC-F247272-1MG 1 mg

Fencamfamin-d5 Hydrochloride

Sign In for Pricing
View Details
Recombinant Human SEMA4A/Semaphorin B Protein (Fc Tag)
PKSH031008 100 µg

Recombinant Human SEMA4A/Semaphorin B Protein (Fc Tag)

Sign In for Pricing
View Details
Cyclo(L-Ala-L-Gly)
TRC-C989770-1G 1 g

Cyclo(L-Ala-L-Gly)

Sign In for Pricing
View Details
BRP44 Antibody
8C14780-AAT 50 µg

BRP44 Antibody

Sign In for Pricing
View Details
Biotin Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743B-01 25 µg

Biotin Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Biotin Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743B-02 100 µg

Biotin Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details