Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE)

This Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q85C42

Expression Region

2-83

Origin

Anthoceros formosae (Hornwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQ EVPLITGRFNSLEQVDEFTRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2Beta,3Alpha,5Alpha,16Beta,17Beta)-17-Acetoxy-3-hydroxy-2-(4-morpholinyl)-16-(1-pyrrolidinyl)androstane
TRC-A165650-25MG 25 mg

2Beta,3Alpha,5Alpha,16Beta,17Beta)-17-Acetoxy-3-hydroxy-2-(4-morpholinyl)-16-(1-pyrrolidinyl)androstane

Sign In for Pricing
View Details
2-[2-(2-Aminophenyl)vinyl]quinolin-8-ol (>90%)
TRC-A615795-50MG 50 mg

2-[2-(2-Aminophenyl)vinyl]quinolin-8-ol (>90%)

Sign In for Pricing
View Details
PEG3 Rabbit Polyclonal Antibody
TA367520 100 µL

PEG3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prrg2 (NM_022999) Mouse Tagged ORF Clone
MG201969 10 µg

Prrg2 (NM_022999) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human SNX24 activation kit by CRISPRa
GA109175 1 Kit

Human SNX24 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TIMP1, Tag Free
HA211003-01 Inquire

Human TIMP1, Tag Free

Sign In for Pricing
View Details