Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE)

This Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q85C42

Expression Region

2-83

Origin

Anthoceros formosae (Hornwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQ EVPLITGRFNSLEQVDEFTRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5PF (NM_001003697) Human Over-expression Lysate
LC423984 20 µg

ATP5PF (NM_001003697) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL-23, C-His Tag
HA210909-01 Inquire

Human IL-23, C-His Tag

Sign In for Pricing
View Details
Human IL-23, C-His Tag
HA210909-02 50 µg

Human IL-23, C-His Tag

Sign In for Pricing
View Details
Human IL-23, C-His Tag
HA210909-03 100 µg

Human IL-23, C-His Tag

Sign In for Pricing
View Details
CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), CF488A conjugate, 0.1mg/mL
BNC881696-100 1x 100 µL

CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFT52 (NM_016004) Human Over-expression Lysate
LC402484 20 µg

IFT52 (NM_016004) Human Over-expression Lysate

Sign In for Pricing
View Details