Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE)

This Recombinant Anthoceros formosae Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q85C42

Expression Region

2-83

Origin

Anthoceros formosae (Hornwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENRQ EVPLITGRFNSLEQVDEFTRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS802414 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Camkk2 Mouse Gene Knockout Kit (CRISPR)
KN502485 1 Kit

Camkk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Chloroindole
TRC-C364270-250MG 250 mg

2-Chloroindole

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), Biotin conjugate, 0.1mg/mL
BNCB2366-100 1x 100 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRB1 Recombinant Rabbit Monoclonal Antibody [JE33-35]
HA722898 100 µL

GABRB1 Recombinant Rabbit Monoclonal Antibody [JE33-35]

Sign In for Pricing
View Details
CHEK1 Polyclonal Antibody
E-AB-62039-01 60 µL

CHEK1 Polyclonal Antibody

Sign In for Pricing
View Details