Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus elongatus ATP synthase subunit c (atpE)

This Recombinant Thermosynechococcus elongatus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8DLP7

Expression Region

1-82

Origin

Thermosynechococcus elongatus (strain BP-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVIALVLLFANPFAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reep1 ORF Vector (Mouse) (pORF)
ORF055839 1.0 µg DNA

Reep1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SEMA4C Blocking Peptide
MBS9627641-01 1 mg

SEMA4C Blocking Peptide

Sign In for Pricing
View Details
SEMA4C Blocking Peptide
MBS9627641-02 5x 1 mg

SEMA4C Blocking Peptide

Sign In for Pricing
View Details
Phospho-RPS6KA1 (Ser352) Antibody Blocking Peptide
orb1503424 500 µg

Phospho-RPS6KA1 (Ser352) Antibody Blocking Peptide

Sign In for Pricing
View Details
Human Oligodendrocyte Specific Protein (CLDN11) (NM_005602) AAV Particle
RC202087A1V 250 µL

Human Oligodendrocyte Specific Protein (CLDN11) (NM_005602) AAV Particle

Sign In for Pricing
View Details
GSK3 beta, phosphorylated (Ser9)
537042 100 µL

GSK3 beta, phosphorylated (Ser9)

Sign In for Pricing
View Details