Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8M9W8

Expression Region

2-83

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFTADRQ EVPLITGRFNSLEQLNEITKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD14 Antibody[M5E2]
E-AB-F12090P-01 25 µg

Purified Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
Purified Anti-Human CD14 Antibody[M5E2]
E-AB-F12090P-02 100 µg

Purified Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
1-(4-Nitrobenzyl)-1H-1,2,4-triazole
TRC-N900988-500MG 500 mg

1-(4-Nitrobenzyl)-1H-1,2,4-triazole

Sign In for Pricing
View Details
Human FAM130A2 (CSRNP3) activation kit by CRISPRa
GA112803 1 Kit

Human FAM130A2 (CSRNP3) activation kit by CRISPRa

Sign In for Pricing
View Details
Human MYCT1 activation kit by CRISPRa
GA112852 1 Kit

Human MYCT1 activation kit by CRISPRa

Sign In for Pricing
View Details
RMND5B (NM_001288794) Human Tagged ORF Clone
RG237938 10 µg

RMND5B (NM_001288794) Human Tagged ORF Clone

Sign In for Pricing
View Details