Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8M9W8

Expression Region

2-83

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFTADRQ EVPLITGRFNSLEQLNEITKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein-α (Ab-133) Antibody
8B7235-AAT 50 µg

Synuclein-α (Ab-133) Antibody

Sign In for Pricing
View Details
CPLX3 (NM_001030005) Human Over-expression Lysate
LY422285 100 µg

CPLX3 (NM_001030005) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF493 activation kit by CRISPRa
GA117154 1 Kit

Human ZNF493 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559231 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Benzo[b]thiophen-2(3H)-one
TRC-B206880-1G 1 g

Benzo[b]thiophen-2(3H)-one

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS641015 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details