Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8YQI2

Expression Region

1-82

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATOH1 (NM_005172) Human Over-expression Lysate
LC401583 20 µg

ATOH1 (NM_005172) Human Over-expression Lysate

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: 3B10]
AM06728SU-N 100 µL

CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: 3B10]

Sign In for Pricing
View Details
JUNB Rabbit Polyclonal Antibody
AP06192PU-N 100 µg

JUNB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF594 conjugate, 0.1mg/mL
BNC940955-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LUZP1 Rabbit Polyclonal Antibody
TA361754 100 µL

LUZP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mupp1 (MPDZ) Rabbit Polyclonal Antibody
TA378611 100 µL

Mupp1 (MPDZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details