Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8YQI2

Expression Region

1-82

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBPMS2 activation kit by CRISPRa
GA117671 1 Kit

Human RBPMS2 activation kit by CRISPRa

Sign In for Pricing
View Details
MIF (NM_002415) Human Recombinant Protein
TP305106 20 µg

MIF (NM_002415) Human Recombinant Protein

Sign In for Pricing
View Details
D-Sorbitol Polyglycidyl Ether (Technical Grade)
TRC-S677108-50G 50 g

D-Sorbitol Polyglycidyl Ether (Technical Grade)

Sign In for Pricing
View Details
SR 1078
TRC-S683900-1MG 1 mg

SR 1078

Sign In for Pricing
View Details
Recombinant Rat CD146/MCAM protein (His tag)
PDER100227-01 20 µg

Recombinant Rat CD146/MCAM protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CD146/MCAM protein (His tag)
PDER100227-02 100 µg

Recombinant Rat CD146/MCAM protein (His tag)

Sign In for Pricing
View Details